Lineage for d3iasj3 (3ias J:334-438)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1992366Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993321Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) (S)
    contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end
  5. 1993329Family a.29.12.0: automated matches [254298] (1 protein)
    not a true family
  6. 1993330Protein automated matches [254684] (1 species)
    not a true protein
  7. 1993331Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries)
  8. 1993338Domain d3iasj3: 3ias J:334-438 [246871]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug11
    complexed with ca, fes, fmn, sf4

Details for d3iasj3

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (J:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3iasj3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iasj3 a.29.12.0 (J:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

SCOPe Domain Coordinates for d3iasj3:

Click to download the PDB-style file with coordinates for d3iasj3.
(The format of our PDB-style files is described here.)

Timeline for d3iasj3:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_