SCOPe 2.08: Domain d3ias13: 3ias 1:334-438

Lineage for d3ias13 (3ias 1:334-438)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families)
   contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end

5. Family a.29.12.0: automated matches [254298] (1 protein)
   not a true family

6. Protein automated matches [254684] (5 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries)

8. Domain d3ias13: 3ias 1:334-438 [246845]
   Other proteins in same PDB: d3ias11, d3ias12, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
   automated match to d2fug11
   complexed with ca, fes, fmn, sf4

Details for d3ias13

PDB Entry: 3ias, 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution

PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3ias13:

Sequence; same for both SEQRES and ATOM records:

>d3ias13 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr

Timeline for d3ias13:

• d3ias13 first appeared in SCOPe 2.04
  
• d3ias13 appears in SCOPe 2.07