Lineage for d3ias31 (3ias 3:1-95)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2158219Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2159798Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2160171Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2160172Protein automated matches [191164] (21 species)
    not a true protein
  7. 2160245Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries)
  8. 2160250Domain d3ias31: 3ias 3:1-95 [246847]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug33
    complexed with ca, fes, fmn, sf4

Details for d3ias31

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3ias31:

Sequence, based on SEQRES records: (download)

>d3ias31 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd
gkpllnekgepeiqwqpklaascvtavadgmvvdt

Sequence, based on observed residues (ATOM records): (download)

>d3ias31 d.15.4.0 (3:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp
klaascvtavadgmvvdt

SCOPe Domain Coordinates for d3ias31:

Click to download the PDB-style file with coordinates for d3ias31.
(The format of our PDB-style files is described here.)

Timeline for d3ias31:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_