SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ias9_ (3ias 9:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2172289Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2172425Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 protein domains)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2172611Protein automated matches [254689] (1 species)
    not a true protein
  7. 2172612Species Thermus thermophilus HB8 [TaxId:300852] [255887] (3 PDB entries)
  8. 2172617Domain d3ias9_: 3ias 9: [246855]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasz_
    automated match to d2fug91
    complexed with ca, fes, fmn, sf4

Details for d3ias9_

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (9:) NADH-quinone oxidoreductase subunit 9

SCOPe Domain Sequences for d3ias9_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ias9_ d.58.1.5 (9:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ypdapvalkprfhgrhvltrhpnglekcigcslcaaacpayaiyvepaendpenpvsage
ryakvyeinmlrcifcglceeacptgaivlgydfemadyeysdlvygkedmlvdvvgtkp
qrreakrtgkpvkvgyvvpyvrpelegfkapteg

SCOPe Domain Coordinates for d3ias9_:

Click to download the PDB-style file with coordinates for d3ias9_.
(The format of our PDB-style files is described here.)

Timeline for d3ias9_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_