Lineage for d3ias11 (3ias 1:2-249)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2152002Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2152003Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (1 family) (S)
  5. 2152004Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 protein domains)
    N-terminal part of Pfam PF01512
  6. 2152011Protein automated matches [254682] (1 species)
    not a true protein
  7. 2152012Species Thermus thermophilus HB8 [TaxId:300852] [255880] (3 PDB entries)
  8. 2152017Domain d3ias11: 3ias 1:2-249 [246843]
    Other proteins in same PDB: d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_
    automated match to d2fug12
    complexed with ca, fes, fmn, sf4

Details for d3ias11

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3ias11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ias11 c.142.1.1 (1:2-249) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
gteqskgm

SCOPe Domain Coordinates for d3ias11:

Click to download the PDB-style file with coordinates for d3ias11.
(The format of our PDB-style files is described here.)

Timeline for d3ias11:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_