SCOPe 2.08: Domain d3iasw_: 3ias W:

Lineage for d3iasw_ (3ias W:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.307: Nqo5-like [143242] (1 superfamily)
   core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel

4. Superfamily d.307.1: Nqo5-like [143243] (1 family)

5. Family d.307.1.1: Nqo5-like [143244] (2 proteins)
   Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329

6. Protein automated matches [254685] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries)

8. Domain d3iasw_: 3ias W: [246891]
   Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasx_, d3iasy_, d3iasz_
   automated match to d2fug51
   complexed with ca, fes, fmn, sf4

Details for d3iasw_

PDB Entry: 3ias, 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution

PDB Compounds: (W:) NADH-quinone oxidoreductase subunit 5

SCOPe Domain Sequences for d3iasw_:

Sequence; same for both SEQRES and ATOM records:

>d3iasw_ d.307.1.1 (W:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

Timeline for d3iasw_:

• d3iasw_ first appeared in SCOPe 2.04
  
• d3iasw_ appears in SCOPe 2.07