Lineage for d3iasf_ (3ias F:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2222239Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2222240Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2222363Family e.19.1.2: Nq06-like [144031] (2 protein domains)
    Pfam PF01058
  6. 2222370Protein automated matches [254687] (1 species)
    not a true protein
  7. 2222371Species Thermus thermophilus HB8 [TaxId:300852] [255885] (3 PDB entries)
  8. 2222377Domain d3iasf_: 3ias F: [246866]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasy_, d3iasz_
    automated match to d2fug61
    complexed with ca, fes, fmn, sf4

Details for d3iasf_

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (F:) NADH-quinone oxidoreductase subunit 6

SCOPe Domain Sequences for d3iasf_:

Sequence, based on SEQRES records: (download)

>d3iasf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d3iasf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarqadvmivagrlskkmap
vmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiya
vmqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d3iasf_:

Click to download the PDB-style file with coordinates for d3iasf_.
(The format of our PDB-style files is described here.)

Timeline for d3iasf_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_, d3iasz_