Lineage for d3iasz_ (3ias Z:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527817Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2527852Family d.82.2.2: Nqo15-like [143572] (1 protein)
    overall structural similarity to the frataxin-like family
    automatically mapped to Pfam PF11497
  6. 2527853Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)
  7. 2527854Species Thermus thermophilus [TaxId:274] [143574] (4 PDB entries)
    Uniprot Q5SKZ7 3-129
  8. 2527862Domain d3iasz_: 3ias Z: [246894]
    Other proteins in same PDB: d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_
    automated match to d2fug71
    complexed with ca, fes, fmn, sf4

Details for d3iasz_

PDB Entry: 3ias (more details), 3.15 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 4 mol/ASU, re-refined to 3.15 angstrom resolution
PDB Compounds: (Z:) NADH-quinone oxidoreductase subunit 15

SCOPe Domain Sequences for d3iasz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iasz_ d.82.2.2 (Z:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

SCOPe Domain Coordinates for d3iasz_:

Click to download the PDB-style file with coordinates for d3iasz_.
(The format of our PDB-style files is described here.)

Timeline for d3iasz_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3ias11, d3ias12, d3ias13, d3ias2_, d3ias31, d3ias32, d3ias33, d3ias34, d3ias4_, d3ias5_, d3ias6_, d3ias7_, d3ias9_, d3iasa1, d3iasa2, d3iasa3, d3iasb_, d3iasc1, d3iasc2, d3iasc3, d3iasc4, d3iasd_, d3iase_, d3iasf_, d3iasg_, d3iash_, d3iasj1, d3iasj2, d3iasj3, d3iask_, d3iasl1, d3iasl2, d3iasl3, d3iasl4, d3iasm_, d3iasn_, d3iaso_, d3iasp_, d3iasq_, d3iass1, d3iass2, d3iass3, d3iast_, d3iasu1, d3iasu2, d3iasu3, d3iasu4, d3iasv_, d3iasw_, d3iasx_, d3iasy_