Lineage for d3iam11 (3iam 1:2-249)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923529Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2923530Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) (S)
  5. 2923531Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 proteins)
    N-terminal part of Pfam PF01512
  6. 2923538Protein automated matches [254682] (2 species)
    not a true protein
  7. 2923539Species Thermus thermophilus HB8 [TaxId:300852] [255880] (3 PDB entries)
  8. 2923540Domain d3iam11: 3iam 1:2-249 [246777]
    Other proteins in same PDB: d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug12
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam11

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (1:) NADH-quinone oxidoreductase subunit 1

SCOPe Domain Sequences for d3iam11:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iam11 c.142.1.1 (1:2-249) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
gteqskgm

SCOPe Domain Coordinates for d3iam11:

Click to download the PDB-style file with coordinates for d3iam11.
(The format of our PDB-style files is described here.)

Timeline for d3iam11: