| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.142: Nqo1 FMN-binding domain-like [142018] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.142.1: Nqo1 FMN-binding domain-like [142019] (2 families) ![]() |
| Family c.142.1.1: Nqo1 FMN-binding domain-like [142020] (2 proteins) N-terminal part of Pfam PF01512 |
| Protein automated matches [254682] (2 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [255880] (3 PDB entries) |
| Domain d3iam11: 3iam 1:2-249 [246777] Other proteins in same PDB: d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug12 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam11:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam11 c.142.1.1 (1:2-249) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
tgpilsgldprfertlyahvgkegswtldyylrhggyetakrvlkektpdevieevkrsg
lrgrggagfptglkwsfmpkddgkqhylicnadesepgsfkdryiledvphlliegmila
gyairatvgyiyvrgeyrraadrleqaikearargylgknlfgtdfsfdlhvhrgagayi
cgeetalmnsleglranprlkppfpaqsglwgkpttinnvetlasvvpimergadwfaqm
gteqskgm
Timeline for d3iam11: