Lineage for d3iamd_ (3iam D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573409Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 2573416Protein automated matches [254688] (1 species)
    not a true protein
  7. 2573417Species Thermus thermophilus HB8 [TaxId:300852] [255886] (3 PDB entries)
  8. 2573419Domain d3iamd_: 3iam D: [246798]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug41
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamd_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (D:) NADH-quinone oxidoreductase subunit 4

SCOPe Domain Sequences for d3iamd_:

Sequence, based on SEQRES records: (download)

>d3iamd_ e.18.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vmtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytpr
mdylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgalt
pffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphridey
ealfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdv
plgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeav
iyhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpya
ckgeqvpdmvaiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d3iamd_ e.18.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
vmtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsf
ahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafr
eretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaes
pifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergd
vfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhy
tegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvp
dmvaiiasldpvmgdvdr

SCOPe Domain Coordinates for d3iamd_:

Click to download the PDB-style file with coordinates for d3iamd_.
(The format of our PDB-style files is described here.)

Timeline for d3iamd_: