![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
![]() | Fold e.18: HydB/Nqo4-like [56761] (1 superfamily) 3 domains: (1) all-alpha; (2&3) alpha+beta |
![]() | Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) ![]() |
![]() | Family e.18.1.2: Nqo4-like [144028] (2 proteins) Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit |
![]() | Protein automated matches [254688] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255886] (3 PDB entries) |
![]() | Domain d3iamd_: 3iam D: [246798] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug41 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iamd_:
Sequence, based on SEQRES records: (download)
>d3iamd_ e.18.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} vmtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytpr mdylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgalt pffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphridey ealfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdv plgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeav iyhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpya ckgeqvpdmvaiiasldpvmgdvdr
>d3iamd_ e.18.1.2 (D:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} vmtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsf ahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafr eretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaes pifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergd vfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhy tegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvp dmvaiiasldpvmgdvdr
Timeline for d3iamd_: