Lineage for d3iam6_ (3iam 6:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573496Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 2573497Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 2573628Family e.19.1.2: Nq06-like [144031] (2 proteins)
    Pfam PF01058
  6. 2573635Protein automated matches [254687] (1 species)
    not a true protein
  7. 2573636Species Thermus thermophilus HB8 [TaxId:300852] [255885] (3 PDB entries)
  8. 2573637Domain d3iam6_: 3iam 6: [246787]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamg_, d3iamh_
    automated match to d2fug61
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam6_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (6:) NADH-quinone oxidoreductase subunit 6

SCOPe Domain Sequences for d3iam6_:

Sequence, based on SEQRES records: (download)

>d3iam6_ e.19.1.2 (6:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records): (download)

>d3iam6_ e.19.1.2 (6:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
mqlqkkvrgqaynergerlppvaa

SCOPe Domain Coordinates for d3iam6_:

Click to download the PDB-style file with coordinates for d3iam6_.
(The format of our PDB-style files is described here.)

Timeline for d3iam6_: