Lineage for d3iam34 (3iam 3:686-777)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2802576Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
    barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
  4. 2802649Superfamily b.52.2: ADC-like [50692] (4 families) (S)
  5. 2802857Family b.52.2.0: automated matches [191648] (1 protein)
    not a true family
  6. 2802858Protein automated matches [191195] (10 species)
    not a true protein
  7. 2802925Species Thermus thermophilus HB8 [TaxId:300852] [255891] (3 PDB entries)
  8. 2802926Domain d3iam34: 3iam 3:686-777 [246784]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug31
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam34

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (3:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3iam34:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iam34 b.52.2.0 (3:686-777) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
kerkgafylrptmwkahqavgkaqeaaraelwahpetaraealpegaqvavetpfgrvea
rvvhredvpkghlylsalgpaaglrvegrvlv

SCOPe Domain Coordinates for d3iam34:

Click to download the PDB-style file with coordinates for d3iam34.
(The format of our PDB-style files is described here.)

Timeline for d3iam34: