![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.307: Nqo5-like [143242] (1 superfamily) core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel |
![]() | Superfamily d.307.1: Nqo5-like [143243] (1 family) ![]() |
![]() | Family d.307.1.1: Nqo5-like [143244] (2 proteins) Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329 |
![]() | Protein automated matches [254685] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries) |
![]() | Domain d3iam5_: 3iam 5: [246786] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug51 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam5_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam5_ d.307.1.1 (5:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg ltfykggsrkgyrslw
Timeline for d3iam5_: