Lineage for d3iam5_ (3iam 5:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010544Fold d.307: Nqo5-like [143242] (1 superfamily)
    core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel
  4. 3010545Superfamily d.307.1: Nqo5-like [143243] (1 family) (S)
  5. 3010546Family d.307.1.1: Nqo5-like [143244] (2 proteins)
    Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329
  6. 3010553Protein automated matches [254685] (2 species)
    not a true protein
  7. 3010554Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries)
  8. 3010555Domain d3iam5_: 3iam 5: [246786]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug51
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iam5_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (5:) NADH-quinone oxidoreductase subunit 5

SCOPe Domain Sequences for d3iam5_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iam5_ d.307.1.1 (5:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

SCOPe Domain Coordinates for d3iam5_:

Click to download the PDB-style file with coordinates for d3iam5_.
(The format of our PDB-style files is described here.)

Timeline for d3iam5_: