Lineage for d3iamc3 (3iam C:247-685)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908420Fold c.81: Formate dehydrogenase/DMSO reductase, domains 1-3 [53705] (1 superfamily)
    contains of two similar intertwined domains related by pseudo dyad; duplication
    core: 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2908421Superfamily c.81.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53706] (2 families) (S)
    molybdopterine enzyme
  5. 2908422Family c.81.1.1: Formate dehydrogenase/DMSO reductase, domains 1-3 [53707] (11 proteins)
    domain 1 (residues 1-55) binds Fe4S4 cluster in FDH but not DMSO reductase
  6. 2908536Protein automated matches [227025] (5 species)
    not a true protein
  7. 2908549Species Thermus thermophilus HB8 [TaxId:300852] [255890] (3 PDB entries)
  8. 2908551Domain d3iamc3: 3iam C:247-685 [246796]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_
    automated match to d2fug32
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamc3

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (C:) NADH-quinone oxidoreductase subunit 3

SCOPe Domain Sequences for d3iamc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iamc3 c.81.1.1 (C:247-685) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
wemeetpttcalcpvgcgitadtrsgellrirarevpevneiwicdagrfghewadqnrl
ktplvrkegrlveatweeaflalkeglkeargeevglylahdatleegllaselakalkt
phldfqgrtaapaslfppasledllqadfalvlgdpteeapilhlrlsefvrdlkpphry
nhgtpfadlqikermprrtdkmalfapyraplmkwaaihevhrpgeereillallgdkeg
semvakakeawekaknpvlilgagvlqdtvaaerarllaerkgakvlamtpaanarglea
mgvlpgakgaswdepgalyayygfvppeealkgkrfvvmhlshlhplaeryahvvlpapt
fyekrghlvnlegrvlplspapiengeaegalqvlallaealgvrppfrlhleaqkalka
rkvpeamgrlsfrlkelrp

SCOPe Domain Coordinates for d3iamc3:

Click to download the PDB-style file with coordinates for d3iamc3.
(The format of our PDB-style files is described here.)

Timeline for d3iamc3: