Lineage for d3iamh_ (3iam H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962311Superfamily d.82.2: Frataxin/Nqo15-like [55387] (3 families) (S)
  5. 2962346Family d.82.2.2: Nqo15-like [143572] (1 protein)
    overall structural similarity to the frataxin-like family
    automatically mapped to Pfam PF11497
  6. 2962347Protein NADH-quinone oxidoreductase subunit 15, Nqo15 [143573] (1 species)
  7. 2962348Species Thermus thermophilus [TaxId:274] [143574] (5 PDB entries)
    Uniprot Q5SKZ7 3-129
  8. 2962350Domain d3iamh_: 3iam H: [246802]
    Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_
    automated match to d2fug71
    complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamh_

PDB Entry: 3iam (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH
PDB Compounds: (H:) NADH-quinone oxidoreductase subunit 15

SCOPe Domain Sequences for d3iamh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iamh_ d.82.2.2 (H:) NADH-quinone oxidoreductase subunit 15, Nqo15 {Thermus thermophilus [TaxId: 274]}
asserelyeawvellswmreyaqakgvrfekeadfpdfiyrmerpydlpttimtaslsdg
lgepflladvsprhaklkriglrlprahihlhahyepgkglvtgkipltkerffaladra
realafa

SCOPe Domain Coordinates for d3iamh_:

Click to download the PDB-style file with coordinates for d3iamh_.
(The format of our PDB-style files is described here.)

Timeline for d3iamh_: