SCOPe 2.08: Domain d3iame_: 3iam E:

Lineage for d3iame_ (3iam E:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.307: Nqo5-like [143242] (1 superfamily)
   core: alpha-beta(2)-alpha-beta(3); 2 layers, a/b; mixed beta-sheet, order 12534, strands 2 and 5 are parallel

4. Superfamily d.307.1: Nqo5-like [143243] (1 family)

5. Family d.307.1.1: Nqo5-like [143244] (2 proteins)
   Globular region is covered by PfamB PB121908 from N-end and then by PfamB PB000646; contains extra C-terminal unstructured region, corresponding to Pfam PF00329

6. Protein automated matches [254685] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255883] (3 PDB entries)

8. Domain d3iame_: 3iam E: [246799]
   Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iamf_, d3iamg_, d3iamh_
   automated match to d2fug51
   complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iame_

PDB Entry: 3iam, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH

PDB Compounds: (E:) NADH-quinone oxidoreductase subunit 5

SCOPe Domain Sequences for d3iame_:

Sequence; same for both SEQRES and ATOM records:

>d3iame_ d.307.1.1 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrlervleearakgypiednglgnlwvvlprerfkeemahykamgfnfladivgldylty
pdprperfavvyelvslpgwkdgdgsrffvrvyvpeedprlptvtdlwgsanflerevyd
lfgivfeghpdlrkiltpedleghplrkdyplgetptlfregryiipaefraaltgkdpg
ltfykggsrkgyrslw

Timeline for d3iame_:

• d3iame_ first appeared in SCOPe 2.04
  
• d3iame_ appears in SCOPe 2.07