| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.12: Nqo1C-terminal domain-like [140490] (2 families) ![]() contains extra C-terminal helix that caps the bundle at one end and Fe4-S4 cluster at the other end |
| Family a.29.12.0: automated matches [254298] (1 protein) not a true family |
| Protein automated matches [254684] (5 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [255882] (3 PDB entries) |
| Domain d3iam13: 3iam 1:334-438 [246779] Other proteins in same PDB: d3iam11, d3iam12, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug11 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iam13:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iam13 a.29.12.0 (1:334-438) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
rvsmvdamwnltrfyahescgkctpcregvagfmvnlfakigtgqgeekdvenleallpl
iegrsfcpladaavwpvkgslrhfkdqylalarekrpvprpslwr
Timeline for d3iam13: