![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily) barrel, closed; n=6, S=10; complex topology |
![]() | Superfamily b.53.1: Ribosomal protein L25-like [50715] (3 families) ![]() |
![]() | Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins) |
![]() | Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species) contains additional all-beta (sub)domain in the C-terminal extension |
![]() | Species Thermus thermophilus [TaxId:274] [63799] (16 PDB entries) |
![]() | Domain d2b9nz1: 2b9n Z:1-175 [144975] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9nz1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9nz1 b.53.1.1 (Z:1-175) Ribosomal protein TL5 (general stress protein CTC) {Thermus thermophilus [TaxId: 274]} meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr
Timeline for d2b9nz1: