Lineage for d2b9n21 (2b9n 2:1-65)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979820Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979846Superfamily a.2.2: Ribosomal protein L29 (L29p) [46561] (1 family) (S)
    automatically mapped to Pfam PF00831
  5. 1979847Family a.2.2.1: Ribosomal protein L29 (L29p) [46562] (1 protein)
  6. 1979848Protein Ribosomal protein L29 (L29p) [46563] (5 species)
  7. 1979932Species Thermus thermophilus [TaxId:274] [140100] (10 PDB entries)
    Uniprot Q5SHP6 12-62
  8. 1979941Domain d2b9n21: 2b9n 2:1-65 [128146]
    Other proteins in same PDB: d2b9n01, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9n21

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (2:) 50S ribosomal protein L29

SCOPe Domain Sequences for d2b9n21:

Sequence, based on SEQRES records: (download)

>d2b9n21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
geegd

Sequence, based on observed residues (ATOM records): (download)

>d2b9n21 a.2.2.1 (2:1-65) Ribosomal protein L29 (L29p) {Thermus thermophilus [TaxId: 274]}
tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
eegd

SCOPe Domain Coordinates for d2b9n21:

Click to download the PDB-style file with coordinates for d2b9n21.
(The format of our PDB-style files is described here.)

Timeline for d2b9n21: