![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.12: Ribosomal proteins S24e, L23 and L15e [54188] (1 superfamily) beta-(alpha)-beta-alpha-beta(2); 3 layers: alpha/beta/alpha; antiparallel beta-sheet: order 1243 |
![]() | Superfamily d.12.1: Ribosomal proteins S24e, L23 and L15e [54189] (3 families) ![]() |
![]() | Family d.12.1.1: L23p [54190] (1 protein) automatically mapped to Pfam PF00276 |
![]() | Protein Ribosomal protein L23 [54191] (4 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89815] (11 PDB entries) |
![]() | Domain d2b9nx1: 2b9n X:1-78 [128160] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9ny1, d2b9nz1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9nx1:
Sequence, based on SEQRES records: (download)
>d2b9nx1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg ekkavvrlsedddaqeva
>d2b9nx1 d.12.1.1 (X:1-78) Ribosomal protein L23 {Thermus thermophilus [TaxId: 274]} swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge kkavvrlsedddqeva
Timeline for d2b9nx1: