Lineage for d2b9nk1 (2b9n K:71-140)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984852Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1984853Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1984854Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1984945Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries)
    Uniprot P36238 70-139! Uniprot P36238 71-137
  8. 1984964Domain d2b9nk1: 2b9n K:71-140 [128153]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nk1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b9nk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nk1 a.4.7.1 (K:71-140) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamkiieg
taksmgievv

SCOPe Domain Coordinates for d2b9nk1:

Click to download the PDB-style file with coordinates for d2b9nk1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nk1: