Lineage for d2b9nu1 (2b9n U:2-118)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017239Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2017277Superfamily a.144.2: Ribosomal protein L20 [74731] (1 family) (S)
    automatically mapped to Pfam PF00453
  5. 2017278Family a.144.2.1: Ribosomal protein L20 [74732] (1 protein)
  6. 2017279Protein Ribosomal protein L20 [74733] (4 species)
  7. 2017319Species Thermus thermophilus [TaxId:274] [158510] (15 PDB entries)
    Uniprot P60491 1-117
  8. 2017333Domain d2b9nu1: 2b9n U:2-118 [144973]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nu1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (U:) 50S ribosomal protein L20

SCOPe Domain Sequences for d2b9nu1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nu1 a.144.2.1 (U:2-118) Ribosomal protein L20 {Thermus thermophilus [TaxId: 274]}
praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq

SCOPe Domain Coordinates for d2b9nu1:

Click to download the PDB-style file with coordinates for d2b9nu1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nu1: