PDB entry 2b9n

View 2b9n on RCSB PDB site
Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
Class: Ribosome
Keywords: ribosome, translation, release factor
Deposited on 2005-10-12, released 2006-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 6.76 Å
R-factor: 0.341
AEROSPACI score: -0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9n01
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-End)
    Domains in SCOPe 2.06: d2b9n21
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b9n31
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-72)
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9n51
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-End)
    Domains in SCOPe 2.06: d2b9n71
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (Start-63)
    Domains in SCOPe 2.06: d2b9n81
  • Chain '9':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (Start-35)
    Domains in SCOPe 2.06: d2b9n91
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-172)
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-245)
    Domains in SCOPe 2.06: d2b9nf1
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9nh1, d2b9nh2
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-148)
    Domains in SCOPe 2.06: d2b9ni1, d2b9ni2
  • Chain 'K':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9nk1, d2b9nk2
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9nn1
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-121)
    Domains in SCOPe 2.06: d2b9no1
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-137)
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b9nr1
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9nt1
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (Start-117)
    Domains in SCOPe 2.06: d2b9nu1
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-99)
    Domains in SCOPe 2.06: d2b9nv1
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b9nw1
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-End)
    Domains in SCOPe 2.06: d2b9nx1
  • Chain 'Y':
    Compound: 50S ribosomal protein 24
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N (0-End)
    Domains in SCOPe 2.06: d2b9ny1
  • Chain 'Z':
    Compound: 50S ribosomal protein CTC
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9N
    Domains in SCOPe 2.06: d2b9nz1

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2b9n0 (0:)
    mahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlf
    alsdgkvvfinkgkgarfisieaaqtevaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n0 (0:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2b9n2 (2:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n2 (2:)
    tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
    eegd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9n3 (3:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain '4':
    No sequence available.

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2b9n5 (5:)
    makhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvlav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n5 (5:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
    

  • Chain '6':
    No sequence available.

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2b9n7 (7:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n7 (7:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2b9n8 (8:)
    mpkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmkl
    mlpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n8 (8:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2b9n9 (9:)
    mkvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9n9 (9:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b9nF (F:)
    meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nF (F:)
    meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs
    grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk
    tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte
    salaevaer
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2b9nH (H:)
    srvgkkpieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhh
    ralhgttrsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegl
    eievpsqtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrlkegktgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nH (H:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2b9nI (I:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
    elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
    iralgytnvpvklhpevtatlkvhvteqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nI (I:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
    elanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkieladai
    ralgytnvpvklhpevtatlkvhvteqk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2b9nK (K:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nK (K:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2b9nN (N:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nN (N:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9nO (O:)
    miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
    vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
    vi
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2b9nR (R:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nR (R:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2b9nT (T:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nT (T:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2b9nU (U:)
    mpraktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrl
    wiqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nU (U:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9nV (V:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2b9nW (W:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nW (W:)
    eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
    hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2b9nX (X:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nX (X:)
    swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
    kkavvrlsedddqeva
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2b9nY (Y:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nY (Y:)
    skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
    nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2b9nZ (Z:)
    mahtgqtaksqgdtatmeltakprtpkqkldesmiaavaynkennvsfaldrkafdrafr
    qqsttglfditveggetfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrs
    qgevqgglvdivvhnlqivapgprripqelvvdvtkmnigdhitagdiklpegctlaadp
    eltvvsvlpprltaeeleaevqaaqvaglvaagelseeaaeavlegdasleevkaeased
    nagtdsednsdaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9nZ (Z:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprlt