![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
![]() | Superfamily b.155.1: L21p-like [141091] (1 family) ![]() automatically mapped to Pfam PF00829 |
![]() | Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
![]() | Protein Ribosomal protein L21p [141093] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
![]() | Domain d2b9nv1: 2b9n V:5-98 [144974] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9nv1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9nv1 b.155.1.1 (V:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d2b9nv1: