Lineage for d2b9nk2 (2b9n K:8-70)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190365Fold d.47: Ribosomal L11/L12e N-terminal domain [54746] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; antiparallel beta-sheet: order 123
  4. 2190366Superfamily d.47.1: Ribosomal L11/L12e N-terminal domain [54747] (1 family) (S)
  5. 2190367Family d.47.1.1: Ribosomal L11/L12e N-terminal domain [54748] (2 proteins)
    Pfam PF03946
  6. 2190371Protein Ribosomal protein L11, N-terminal domain [54749] (4 species)
  7. 2190410Species Thermus thermophilus [TaxId:274] [160200] (17 PDB entries)
    Uniprot P36238 1-70! Uniprot P36238 2-68! Uniprot P36238 2-70
  8. 2190432Domain d2b9nk2: 2b9n K:8-70 [128154]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nk2

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (K:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2b9nk2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nk2 d.47.1.1 (K:8-70) Ribosomal protein L11, N-terminal domain {Thermus thermophilus [TaxId: 274]}
qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
fii

SCOPe Domain Coordinates for d2b9nk2:

Click to download the PDB-style file with coordinates for d2b9nk2.
(The format of our PDB-style files is described here.)

Timeline for d2b9nk2: