Lineage for d2b9nz1 (2b9n Z:1-175)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805051Fold b.53: Ribosomal protein L25-like [50714] (1 superfamily)
    barrel, closed; n=6, S=10; complex topology
  4. 805052Superfamily b.53.1: Ribosomal protein L25-like [50715] (2 families) (S)
  5. 805053Family b.53.1.1: Ribosomal protein L25-like [50716] (2 proteins)
  6. 805088Protein Ribosomal protein TL5 (general stress protein CTC) [63798] (2 species)
    contains additional all-beta (sub)domain in the C-terminal extension
  7. 805089Species Deinococcus radiodurans [TaxId:1299] [159200] (10 PDB entries)
    Uniprot Q9RX88 1-175
  8. 805098Domain d2b9nz1: 2b9n Z:1-175 [144975]
    Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1
    automatically matched to 2ZJR S:1-175

Details for d2b9nz1

PDB Entry: 2b9n (more details), 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.
PDB Compounds: (Z:) 50S ribosomal protein CTC

SCOP Domain Sequences for d2b9nz1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b9nz1 b.53.1.1 (Z:1-175) Ribosomal protein TL5 (general stress protein CTC) {Deinococcus radiodurans [TaxId: 1299]}
meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlppr

SCOP Domain Coordinates for d2b9nz1:

Click to download the PDB-style file with coordinates for d2b9nz1.
(The format of our PDB-style files is described here.)

Timeline for d2b9nz1: