SCOPe 2.08: Domain d1yl351: 1yl3 5:2-59

Lineage for d1yl351 (1yl3 5:2-59)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (8 families)

5. Family g.41.8.5: Ribosomal protein L32p [144200] (1 protein)
   Pfam PF01783; metal ion-binding site is lost in some members; includes the N-terminal, mainly helical tail

6. Protein Ribosomal protein L32p [144201] (3 species)

7. Species Thermus thermophilus [TaxId:274] [161177] (11 PDB entries)
   Uniprot P80339 1-59

8. Domain d1yl351: 1yl3 5:2-59 [144693]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl351

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (5:) 50S ribosomal protein L32

SCOPe Domain Sequences for d1yl351:

Sequence; same for both SEQRES and ATOM records:

>d1yl351 g.41.8.5 (5:2-59) Ribosomal protein L32p {Thermus thermophilus [TaxId: 274]}
akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla

Timeline for d1yl351:

• d1yl351 first appeared in SCOP 1.75
  
• d1yl351 appears in SCOPe 2.07