SCOPe 2.08: Domain d1yl3u1: 1yl3 U:1-113

Lineage for d1yl3u1 (1yl3 U:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins)

6. Protein Ribosomal proteins L24 (L24p) [50106] (4 species)

7. Species Thermus thermophilus [TaxId:274] [159025] (15 PDB entries)
   Uniprot Q72I15 2-102

8. Domain d1yl3u1: 1yl3 U:1-113 [123593]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3u1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (U:) 50S ribosomal protein L24

SCOPe Domain Sequences for d1yl3u1:

Sequence, based on SEQRES records:

>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Sequence, based on observed residues (ATOM records):

>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Thermus thermophilus [TaxId: 274]}
skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle

Timeline for d1yl3u1:

• d1yl3u1 first appeared in SCOP 1.73
  
• d1yl3u1 appears in SCOPe 2.07