Class b: All beta proteins [48724] (165 folds) |
Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (6 families) many known members contain KOW motif |
Family b.34.5.1: Ribosomal proteins L24p and L21e [50105] (2 proteins) |
Protein Ribosomal proteins L24 (L24p) [50106] (2 species) |
Species Archaeon Haloarcula marismortui [TaxId:2238] [50107] (44 PDB entries) |
Domain d1yl3u1: 1yl3 U:1-113 [123593] Other proteins in same PDB: d1yl301, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3w1, d1yl3x1 automatically matched to d1ffkq_ |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOP Domain Sequences for d1yl3u1:
Sequence, based on SEQRES records: (download)
>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
>d1yl3u1 b.34.5.1 (U:1-113) Ribosomal proteins L24 (L24p) {Archaeon Haloarcula marismortui [TaxId: 2238]} skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
Timeline for d1yl3u1: