Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) |
Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
Protein Prokaryotic ribosomal protein L30 [55131] (3 species) short-chain member of the family |
Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries) |
Domain d1yl3x1: 1yl3 X:1-60 [123595] Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl3x1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl3x1 d.59.1.1 (X:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]} mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
Timeline for d1yl3x1:
View in 3D Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1 |