Lineage for d1yl3c1 (1yl3 C:5-228)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019720Fold e.24: Ribosomal protein L1 [56807] (1 superfamily)
    2 domains: (1) alpha+beta; (2) alpha/beta (interrupts domain 1)
  4. 3019721Superfamily e.24.1: Ribosomal protein L1 [56808] (1 family) (S)
    automatically mapped to Pfam PF00687
  5. 3019722Family e.24.1.1: Ribosomal protein L1 [56809] (1 protein)
  6. 3019723Protein Ribosomal protein L1 [56810] (4 species)
  7. 3019734Species Thermus thermophilus [TaxId:274] [56811] (13 PDB entries)
  8. 3019750Domain d1yl3c1: 1yl3 C:5-228 [144697]
    Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3c1

PDB Entry: 1yl3 (more details), 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.
PDB Compounds: (C:) 50s ribosomal protein l1

SCOPe Domain Sequences for d1yl3c1:

Sequence, based on SEQRES records: (download)

>d1yl3c1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsl
phglgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavg
sklgrilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppek
ladnirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

Sequence, based on observed residues (ATOM records): (download)

>d1yl3c1 e.24.1.1 (C:5-228) Ribosomal protein L1 {Thermus thermophilus [TaxId: 274]}
kryrallekvdpnkiytideaahlvkelatakfdetvevhaklgidprrsdqnvrgtvsg
lgkqvrvlaiakgekikeaeeagadyvggeeiiqkildgwmdfdavvatpdvmgavgskl
grilgprgllpnpkagtvgfnigeiireikagriefrndktgaihapvgkasfppeklad
nirafiraleahkpegakgtflrsvyvtttmgpsvrinphs

SCOPe Domain Coordinates for d1yl3c1:

Click to download the PDB-style file with coordinates for d1yl3c1.
(The format of our PDB-style files is described here.)

Timeline for d1yl3c1: