SCOPe 2.08: Domain d1yl3r1: 1yl3 R:4-56

Lineage for d1yl3r1 (1yl3 R:4-56)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.6: Ribosomal protein L24e [57749] (1 protein)
   automatically mapped to Pfam PF01246

6. Protein Ribosomal protein L24e [57750] (1 species)

7. Species Haloarcula marismortui [TaxId:2238] [57751] (44 PDB entries)
   Uniprot P14116

8. Domain d1yl3r1: 1yl3 R:4-56 [123590]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3r1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (R:) 50S ribosomal protein L19

SCOPe Domain Sequences for d1yl3r1:

Sequence, based on SEQRES records:

>d1yl3r1 g.39.1.6 (R:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar

Sequence, based on observed residues (ATOM records):

>d1yl3r1 g.39.1.6 (R:4-56) Ribosomal protein L24e {Haloarcula marismortui [TaxId: 2238]}
recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar

Timeline for d1yl3r1:

• d1yl3r1 first appeared in SCOP 1.73
  
• d1yl3r1 appears in SCOPe 2.07