Class b: All beta proteins [48724] (180 folds) |
Fold b.155: L21p-like [141090] (1 superfamily) core: sandwich, 6 strands in 2 sheets |
Superfamily b.155.1: L21p-like [141091] (1 family) automatically mapped to Pfam PF00829 |
Family b.155.1.1: Ribosomal protein L21p [141092] (1 protein) Pfam PF00829 |
Protein Ribosomal protein L21p [141093] (3 species) |
Species Thermus thermophilus [TaxId:274] [158939] (15 PDB entries) Uniprot P60492 1-101 |
Domain d1yl321: 1yl3 2:5-98 [144691] Other proteins in same PDB: d1yl301, d1yl311, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |
PDB Entry: 1yl3 (more details), 5.5 Å
SCOPe Domain Sequences for d1yl321:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yl321 b.155.1.1 (2:5-98) Ribosomal protein L21p {Thermus thermophilus [TaxId: 274]} iqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaevvehg rgkkiyirkyksgvqyrrrtghrqnftaikilgi
Timeline for d1yl321:
View in 3D Domains from other chains: (mouse over for more information) d1yl301, d1yl311, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i1, d1yl3i2, d1yl3j1, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1 |