SCOPe 2.08: Domain d1yl3j1: 1yl3 J:1-57

Lineage for d1yl3j1 (1yl3 J:1-57)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.108: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48299] (1 superfamily)
   multihelical; intertwined tetramer

4. Superfamily a.108.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48300] (1 family)

5. Family a.108.1.1: Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48301] (1 protein)

6. Protein Ribosomal protein L7/12, oligomerisation (N-terminal) domain [48302] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [48303] (6 PDB entries)

8. Domain d1yl3j1: 1yl3 J:1-57 [123582]
   Other proteins in same PDB: d1yl301, d1yl311, d1yl321, d1yl331, d1yl351, d1yl371, d1yl381, d1yl391, d1yl3c1, d1yl3d1, d1yl3d2, d1yl3f1, d1yl3h1, d1yl3h2, d1yl3i2, d1yl3j2, d1yl3k1, d1yl3k2, d1yl3l1, d1yl3l2, d1yl3m1, d1yl3n1, d1yl3r1, d1yl3s1, d1yl3t1, d1yl3u1, d1yl3v1, d1yl3w1, d1yl3x1

Details for d1yl3j1

PDB Entry: 1yl3, 5.5 Å

PDB Description: Crystal structure of 70S ribosome with thrS operator and tRNAs. Large subunit. The coordinates for the small subunit are in the pdb entry 1YL4.

PDB Compounds: (J:) 50S ribosomal protein L7/L12

SCOPe Domain Sequences for d1yl3j1:

Sequence; same for both SEQRES and ATOM records:

>d1yl3j1 a.108.1.1 (J:1-57) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Thermotoga maritima [TaxId: 2336]}
mtideiieaiekltvselaelvkkledkfgvtaaapvavaaapvagaaagaaqeekt

Timeline for d1yl3j1:

• d1yl3j1 first appeared in SCOP 1.73
  
• d1yl3j1 appears in SCOPe 2.07