![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-2 (IL-2) [47301] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47302] (20 PDB entries) |
![]() | Domain d2b5ia_: 2b5i A: [127895] Other proteins in same PDB: d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2 automated match to d1irl__ complexed with nag |
PDB Entry: 2b5i (more details), 2.3 Å
SCOPe Domain Sequences for d2b5ia_:
Sequence, based on SEQRES records: (download)
>d2b5ia_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfc qsiistlt
>d2b5ia_ a.26.1.2 (A:) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqslrprdlisninvivlelkgfmceyadetativeflnrwitfcqsiistlt
Timeline for d2b5ia_: