SCOPe 2.08: Domain d2b5ib2: 2b5i B:104-207

Lineage for d2b5ib2 (2b5i B:104-207)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (2 families)
Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
Pfam PF00041
Protein Interleukin-2 receptor beta chain [141047] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
Domain d2b5ib2: 2b5i B:104-207 [127897]
Other proteins in same PDB: d2b5ia_, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2
complexed with nag

Details for d2b5ib2

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex

PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOPe Domain Sequences for d2b5ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
lrlmapislqvvhvethrcnisweisqashyferhlefeartlspghtweeaplltlkqk
qewicletltpdtqyefqvrvkplqgefttwspwsqplafrtkp

SCOPe Domain Coordinates for d2b5ib2:

Click to download the PDB-style file with coordinates for d2b5ib2.
(The format of our PDB-style files is described here.)

Timeline for d2b5ib2: