Lineage for d2b5ib1 (2b5i B:6-103)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2359286Protein Interleukin-2 receptor beta chain [141047] (1 species)
  7. 2359287Species Human (Homo sapiens) [TaxId:9606] [141048] (4 PDB entries)
    Uniprot P14784 130-232! Uniprot P14784 130-233! Uniprot P14784 32-129
  8. 2359290Domain d2b5ib1: 2b5i B:6-103 [127896]
    Other proteins in same PDB: d2b5ia_, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2
    complexed with nag

Details for d2b5ib1

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (B:) Interleukin-2 receptor beta chain

SCOPe Domain Sequences for d2b5ib1:

Sequence, based on SEQRES records: (download)

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqdgalqdtscqvhawpdrrrwqqtcellpvsqaswacnlilg
apdsqklttvdivtlrvlcregvrwrvmaiqdfkpfen

Sequence, based on observed residues (ATOM records): (download)

>d2b5ib1 b.1.2.1 (B:6-103) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]}
sqftcfynsraqiscvwsqtscqvhawpdrrrwqqtcellpvsqaswacnlilgapdsqk
lttvdivtlrvlcregvrwrvmaiqdfkpfen

SCOPe Domain Coordinates for d2b5ib1:

Click to download the PDB-style file with coordinates for d2b5ib1.
(The format of our PDB-style files is described here.)

Timeline for d2b5ib1: