Lineage for d2b5id2 (2b5i D:103-165)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034273Protein Interleukin-2 receptor alpha chain [144117] (1 species)
    consists of two segment-swapped SCR domains
  7. 3034274Species Human (Homo sapiens) [TaxId:9606] [144118] (5 PDB entries)
    Uniprot P01589 121-186! Uniprot P01589 124-186! Uniprot P01589 125-186! Uniprot P01589 22-85
  8. 3034278Domain d2b5id2: 2b5i D:103-165 [127901]
    Other proteins in same PDB: d2b5ia_, d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2
    complexed with nag

Details for d2b5id2

PDB Entry: 2b5i (more details), 2.3 Å

PDB Description: cytokine receptor complex
PDB Compounds: (D:) Interleukin-2 receptor alpha chain

SCOPe Domain Sequences for d2b5id2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]}
hcrepppweneateriyhfvvgqmvyyqcvqgyralhrgpaesvckmthgktrwtqpqli
ctg

SCOPe Domain Coordinates for d2b5id2:

Click to download the PDB-style file with coordinates for d2b5id2.
(The format of our PDB-style files is described here.)

Timeline for d2b5id2: