Class a: All alpha proteins [46456] (258 folds) |
Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (3 families) there are two different topoisomers of this fold with different entanglements of the two crossover connections |
Family a.26.1.2: Short-chain cytokines [47286] (11 proteins) |
Protein Interleukin-2 (IL-2) [47301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [47302] (14 PDB entries) |
Domain d2b5ia1: 2b5i A:6-133 [127895] Other proteins in same PDB: d2b5ib1, d2b5ib2, d2b5ic1, d2b5ic2, d2b5id1, d2b5id2 automatically matched to d1m48b_ complexed with nag; mutant |
PDB Entry: 2b5i (more details), 2.3 Å
SCOP Domain Sequences for d2b5ia1:
Sequence, based on SEQRES records: (download)
>d2b5ia1 a.26.1.2 (A:6-133) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqsknfhlrprdlisninvivlelkgsettfmceyadetativeflnrwitfc qsiistlt
>d2b5ia1 a.26.1.2 (A:6-133) Interleukin-2 (IL-2) {Human (Homo sapiens) [TaxId: 9606]} stkktqlqlehllldlqmilnginnyknpkltrmltfkfympkkatelkhlqcleeelkp leevlnlaqslrprdlisninvivlelkgfmceyadetativeflnrwitfcqsiistlt
Timeline for d2b5ia1: