Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) automatically mapped to Pfam PF01194 |
Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins) Zn-binding site is near the N-terminus |
Protein RNA polymerase subunit RPB10 [46926] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries) Uniprot P22139; part of multichain biological unit |
Domain d1twcj_: 1twc J: [112721] Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twci1, d1twci2, d1twck_, d1twcl_ protein/RNA complex; complexed with gtp, mn, zn |
PDB Entry: 1twc (more details), 3 Å
SCOPe Domain Sequences for d1twcj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twcj_ a.4.11.1 (J:) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf lryn
Timeline for d1twcj_: