Lineage for d1twci2 (1twc I:50-121)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036360Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) (S)
  5. 3036361Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)
  6. 3036362Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
    contains two differently decorated domains of this fold
  7. 3036363Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
    Uniprot P27999; part of multichain biological unit
  8. 3036371Domain d1twci2: 1twc I:50-121 [112720]
    Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twcj_, d1twck_, d1twcl_
    protein/RNA complex; complexed with gtp, mn, zn

Details for d1twci2

PDB Entry: 1twc (more details), 3 Å

PDB Description: RNA polymerase II complexed with GTP
PDB Compounds: (I:) DNA-directed RNA polymerase II 14.2kd polypeptide

SCOPe Domain Sequences for d1twci2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twci2 g.41.3.1 (I:50-121) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnigetagvvqdigsdptlprsdrecpkchsrenvffqsqqrrkdtsmvlffvclscshi
ftsdqknkrtqf

SCOPe Domain Coordinates for d1twci2:

Click to download the PDB-style file with coordinates for d1twci2.
(The format of our PDB-style files is described here.)

Timeline for d1twci2: