SCOPe 2.08: Domain d1twce1: 1twc E:1-143

Lineage for d1twce1 (1twc E:1-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family)

5. Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)

6. Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
   Uniprot P20434; part of multichain biological unit

8. Domain d1twce1: 1twc E:1-143 [112715]
   Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce2, d1twcf_, d1twch_, d1twci1, d1twci2, d1twcj_, d1twck_, d1twcl_
   protein/RNA complex; complexed with gtp, mn, zn

Details for d1twce1

PDB Entry: 1twc, 3 Å

PDB Description: RNA polymerase II complexed with GTP

PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d1twce1:

Sequence; same for both SEQRES and ATOM records:

>d1twce1 c.52.3.1 (E:1-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mdqenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsf
qanpteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsa
mklvpsippatietfneaalvvn

Timeline for d1twce1:

• d1twce1 first appeared in SCOP 1.71
  
• d1twce1 appears in SCOPe 2.07