| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.2: RPB6 [55294] (2 proteins) |
| Protein RPB6 [55295] (3 species) essential subunit of RNA polymerases I, II and III |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64318] (31 PDB entries) Uniprot P20435; part of multichain biological unit |
| Domain d1twcf_: 1twc F: [112717] Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twch_, d1twci1, d1twci2, d1twcj_, d1twck_, d1twcl_ protein/RNA complex; complexed with gtp, mn, zn |
PDB Entry: 1twc (more details), 3 Å
SCOPe Domain Sequences for d1twcf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twcf_ a.143.1.2 (F:) RPB6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kaipkdqrattpymtkyerarilgtralqismnapvfvdlegetdplriamkelaekkip
lvirrylpdgsfedwsveelivd
Timeline for d1twcf_: