Lineage for d1twck_ (1twc K:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958258Family d.74.3.2: RBP11/RpoL [64311] (4 proteins)
  6. 2958268Protein RPB11 [64312] (2 species)
  7. 2958269Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64313] (23 PDB entries)
    Uniprot P38902; part of multichain biological unit
  8. 2958273Domain d1twck_: 1twc K: [112722]
    Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twce2, d1twcf_, d1twch_, d1twci1, d1twci2, d1twcj_, d1twcl_
    protein/RNA complex; complexed with gtp, mn, zn

Details for d1twck_

PDB Entry: 1twc (more details), 3 Å

PDB Description: RNA polymerase II complexed with GTP
PDB Compounds: (K:) DNA-directed RNA polymerase II 13.6 kDa polypeptide

SCOPe Domain Sequences for d1twck_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1twck_ d.74.3.2 (K:) RPB11 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mnapdrfelfllgegesklkidpdtkapnavvitfekedhtlgnliraellndrkvlfaa
ykvehpffarfklriqttegydpkdalknacnsiinklgalktnfetewnlqtl

SCOPe Domain Coordinates for d1twck_:

Click to download the PDB-style file with coordinates for d1twck_.
(The format of our PDB-style files is described here.)

Timeline for d1twck_: