Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.78: RPB5-like RNA polymerase subunit [55286] (1 superfamily) core: beta-alpha-beta-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.78.1: RPB5-like RNA polymerase subunit [55287] (2 families) automatically mapped to Pfam PF01191 |
Family d.78.1.1: RPB5 [55288] (2 proteins) |
Protein Eukaryotic RPB5 C-terminal domain [55292] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [55293] (27 PDB entries) Uniprot P20434; part of multichain biological unit |
Domain d1twce2: 1twc E:144-215 [112716] Other proteins in same PDB: d1twca_, d1twcb_, d1twcc1, d1twcc2, d1twce1, d1twcf_, d1twch_, d1twci1, d1twci2, d1twcj_, d1twck_, d1twcl_ protein/RNA complex; complexed with gtp, mn, zn |
PDB Entry: 1twc (more details), 3 Å
SCOPe Domain Sequences for d1twce2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1twce2 d.78.1.1 (E:144-215) Eukaryotic RPB5 C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ithhelvpkhirlssdekrellkryrlkesqlpriqradpvalylglkrgevvkiirkse tsgryasyricm
Timeline for d1twce2: