Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.37: Photosystem II reaction center protein I, PsbI [161041] (1 family) automatically mapped to Pfam PF02532 |
Family f.23.37.1: PsbI-like [161042] (1 protein) Pfam PF02532 |
Protein Photosystem II reaction center protein I, PsbI [161043] (3 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [224950] (24 PDB entries) |
Domain d7cjii_: 7cji i: [403272] Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_ automated match to d2axti1 complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl |
PDB Entry: 7cji (more details), 2.35 Å
SCOPe Domain Sequences for d7cjii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7cjii_ f.23.37.1 (i:) Photosystem II reaction center protein I, PsbI {Thermosynechococcus vulcanus [TaxId: 32053]} metlkitvyivvtffvllfvfgflsgdparnpkrkdle
Timeline for d7cjii_: