Lineage for d7cjil_ (7cji L:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026391Superfamily f.23.31: Photosystem II reaction center protein L, PsbL [161017] (1 family) (S)
    automatically mapped to Pfam PF02419
  5. 3026392Family f.23.31.1: PsbL-like [161018] (2 proteins)
    Pfam PF02419
  6. 3026393Protein Photosystem II reaction center protein L, PsbL [161019] (2 species)
  7. 3026401Species Thermosynechococcus vulcanus [TaxId:32053] [192655] (30 PDB entries)
  8. 3026415Domain d7cjil_: 7cji L: [403170]
    Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
    automated match to d3a0hl_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjil_

PDB Entry: 7cji (more details), 2.35 Å

PDB Description: photosystem ii structure in the s1 state
PDB Compounds: (L:) Photosystem II reaction center protein L

SCOPe Domain Sequences for d7cjil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjil_ f.23.31.1 (L:) Photosystem II reaction center protein L, PsbL {Thermosynechococcus vulcanus [TaxId: 32053]}
epnpnrqpvelnrtslylglllilvlallfssyffn

SCOPe Domain Coordinates for d7cjil_:

Click to download the PDB-style file with coordinates for d7cjil_.
(The format of our PDB-style files is described here.)

Timeline for d7cjil_: