SCOPe 2.08: Domain d7cjim_: 7cji M:

Lineage for d7cjim_ (7cji M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family)
   automatically mapped to Pfam PF05151

5. Family f.23.35.1: PsbM-like [161034] (2 proteins)
   Pfam PF05151

6. Protein Photosystem II reaction center protein M, PsbM [161035] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189918] (21 PDB entries)

8. Domain d7cjim_: 7cji M: [403177]
   Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
   automated match to d2axtm1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjim_

PDB Entry: 7cji, 2.35 Å

PDB Description: photosystem ii structure in the s1 state

PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7cjim_:

Sequence; same for both SEQRES and ATOM records:

>d7cjim_ f.23.35.1 (M:) Photosystem II reaction center protein M, PsbM {Thermosynechococcus vulcanus [TaxId: 32053]}
mevnqlgliatalfvlvpsvfliilyvqtesqq

Timeline for d7cjim_:

• d7cjim_ first appeared in SCOPe 2.07