SCOPe 2.08: Domain d7cjie_: 7cji e:

Lineage for d7cjie_ (7cji e:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family)

5. Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
   Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284

6. Protein Cytochrome b559 subunit alpha, PsbE [161047] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189913] (22 PDB entries)

8. Domain d7cjie_: 7cji e: [403190]
   Other proteins in same PDB: d7cjia_, d7cjib_, d7cjic_, d7cjid_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
   automated match to d2axte1
   complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl
   has additional insertions and/or extensions that are not grouped together

Details for d7cjie_

PDB Entry: 7cji, 2.35 Å

PDB Description: photosystem ii structure in the s1 state

PDB Compounds: (e:) Cytochrome b559 subunit alpha

SCOPe Domain Sequences for d7cjie_:

Sequence; same for both SEQRES and ATOM records:

>d7cjie_ f.23.38.1 (e:) Cytochrome b559 subunit alpha, PsbE {Thermosynechococcus vulcanus [TaxId: 32053]}
gerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsipl
vtdrfeakqqvetfleqlk

Timeline for d7cjie_:

• d7cjie_ first appeared in SCOPe 2.07