Lineage for d7cjib_ (7cji B:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028864Fold f.55: Photosystem II antenna protein-like [161076] (1 superfamily)
    6 transmembrane helices arranged in three antiparallel pairs (hairpins), segregated by cofactors; there can be insertions of different small subdomains in different exposed loops
  4. 3028865Superfamily f.55.1: Photosystem II antenna protein-like [161077] (1 family) (S)
    automatically mapped to Pfam PF00421
  5. 3028866Family f.55.1.1: Photosystem II antenna protein-like [161078] (3 proteins)
    Pfam PF00421
  6. 3028885Protein automated matches [191285] (5 species)
    not a true protein
  7. 3028901Species Thermosynechococcus vulcanus [TaxId:32053] [189912] (36 PDB entries)
  8. 3028932Domain d7cjib_: 7cji B: [403158]
    Other proteins in same PDB: d7cjia_, d7cjid_, d7cjie_, d7cjif_, d7cjih_, d7cjii_, d7cjij_, d7cjik_, d7cjil_, d7cjim_, d7cjio_, d7cjit_, d7cjiu_, d7cjiv_, d7cjix_, d7cjiz_
    automated match to d4il6b_
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hec, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, sqd, unl

Details for d7cjib_

PDB Entry: 7cji (more details), 2.35 Å

PDB Description: photosystem ii structure in the s1 state
PDB Compounds: (B:) Photosystem II CP47 reaction center protein

SCOPe Domain Sequences for d7cjib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cjib_ f.55.1.1 (B:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
glpwyrvhtvlindpgrliaahlmhtalvagwagsmalyelatfdpsdpvlnpmwrqgmf
vlpfmarlgvtgswsgwsitgetgidpgfwsfegvalahivlsgllflaacwhwvywdle
lfrdprtgepaldlpkmfgihlflagllcfgfgafhltglfgpgmwvsdpygltgsvqpv
apewgpdgfnpynpggvvahhiaagivgiiaglfhilvrppqrlykalrmgnietvlsss
iaavffaafvvagtmwygsattpielfgptryqwdssyfqqeinrrvqaslasgatleea
wsaipeklafydyignnpakgglfrtgpmnkgdgiaqawkghavfrnkegeelfvrrmpa
ffesfpviltdkngvvkadipfrraeskysfeqqgvtvsfyggelngqtftdpptvksya
rkaifgeifefdtetlnsdgifrtsprgwftfahavfallfffghiwhgartlfrdvfsg
idpelspeqvewgfyqkvgdvttr

SCOPe Domain Coordinates for d7cjib_:

Click to download the PDB-style file with coordinates for d7cjib_.
(The format of our PDB-style files is described here.)

Timeline for d7cjib_: